eXTReMe Scraping API
Scrape & Compliancy Results
| URL: | https://sercom.eu  (UTC) |
| Request ID: | 2025-11-19-00-32-35-Mu06O9Rnp394Bo37dNPk |
| Scraper Location: | EU |
| Scrape Status: | Success View Full API JSON |
 |
|
eXTReMe Scraping API| URL: | https://sercom.eu (UTC) |
| Request ID: | 2025-11-19-00-32-35-Mu06O9Rnp394Bo37dNPk |
| Scraper Location: | EU |
| Scrape Status: | Success View Full API JSON |
|
|
|
| Title: SKOV-SERCOM B.V. | Horti Climate Solutions |
| Description: SKOV-SERCOM builds electronics and computers for process automation. We are specialised in various sectors, e.g. horticulture and flower bulbs. |
| Top 25 Nouns: skovsercom products contact sector automation bulb computers farming flower process storage accessory arable back builds chicory click cold company conditions cookies customers device electronics emailcontact |
| Category | Domain | Compliancy Score Higher is better |
Tracking Cookies Before / Accept / Necessary Consent |
Tracking Pixels Before / Accept / Necessary Consent |
Cookie Banner | |
|---|---|---|---|---|---|---|
| Food |  |
sercom.eu |
9542 | 2 / 0 / 0 | 1 / 1 / 1 | Accept / Necessary |
| Domain | Compliancy Score Before / Accept / Necessary Consent |
|---|
|
Food |
9542 |
| Tracking Cookies | 2 / 0 / 0 | |
| Tracking Pixels | 1 / 1 / 1 | |
| Cookie Banner | Accept / Necessary |
| Cookie Banner Found | Yes: Complianz |
| Cookie Banner Accept All Button Found | Yes |
| Cookie Banner Necessary Only Button Found | Yes |
| Google Consent Mode Found | No |
| GCM V2 Basic Mode Found | No |
| GCM V2 Advanced Mode Found | No |
| GCM V2 Misconfiguration Found | No |
| Bing Ads UET Consent Mode Found | No |
Before / Accept / Necessary Consent | |
| Google Requests | 4 / 2 / 1 |
| Google Analytics Pixels | 1 / 1 / 1 |
| Google Ads Pixels | 0 / 0 / 0 |
Before / Accept / Necessary Consent | |
| Analytics Requests | 3 / 2 / 1 |
| Marketing Requests | 0 / 0 / 0 |
| Ads Requests | 0 / 0 / 0 |
| Total Requests | 80 / 3 / 1 |
Before / Accept / Necessary Consent | |
| Tracking Cookies | 2 / 0 / 0 |
| First-Party Cookies | 4 / 7 / 7 |
| Third-Party Cookies | 0 / 0 / 0 |
| Third-Party Tags Cookies | 2 / 7 / 7 |
| Persistent Cookies With ID | 2 / 0 / 0 |
| Total Cookies | 4 / 7 / 7 |
Before / Accept / Necessary Consent | |
| Europe Requests | 73 / 3 / 1 |
| North America Requests | 1 / 0 / 0 |
| Asia Requests | 0 / 0 / 0 |
| South America Requests | 0 / 0 / 0 |
| Africa Requests | 0 / 0 / 0 |
| Oceania Requests | 0 / 0 / 0 |
Before / Accept / Necessary Consent | |
| Data Transferred | 2.6MB / 0.1MB / <0.1MB |
| Network Transfering Time | 2.1s / 0.1s / <0.1s |
| Quic Security Protocol | 10 |
| TLS 1.3 Security Protocol | 67 |
| TLS 1.2 Security Protocol | 0 |
| HTTP 200 Responses | 82 |
| HTTP 300 Responses | 0 |
| HTTP 400 Responses | 1 |
| HTTP 500 Responses | 0 |
| H3 Protocol | 10 |
| H2 Protocol | 67 |
| HTTP 1.1 Protocol | 0 |
| HTTP 1 Protocol | 0 |
| Data Protocol | 6 |
| Blob Protocol | 0 |
| Number of Words | 119 |
| Top 25 Nouns: skovsercom products contact sector automation bulb computers farming flower process storage accessory arable back builds chicory click cold company conditions cookies customers device electronics emailcontact | |
| Number of HREFs | 81 |
| Number of IMGs | 38 |
| Number of BUTTONs | 0 |
| Number of FORMs | 2 |
| Number of HEADINGs | 6 |
| Number of PARAGRAPHs | 12 |
|
|
|
|
||||||||||||||||||||||||||||||
|
|
||||||||||||||||||||||||||
|
|
|
|
||||||||||||||||
| Google Consent Mode | Bing Ads Consent Mode | ||
| before_consent | analytics_storage | ✘ N/A | - |
| ad_personalization | ✘ N/A | - | |
| ad_storage | ✘ N/A | ✔ N/A | |
| ad_user_data | ✘ N/A | - | |
| functionality_storage | ✘ N/A | - | |
| personalization_storage | ✘ N/A | - | |
| security_storage | ✘ N/A | - | |
| after_accept_all_consent | analytics_storage | ✘ N/A | - |
| ad_personalization | ✘ N/A | - | |
| ad_storage | ✘ N/A | ✔ N/A | |
| ad_user_data | ✘ N/A | - | |
| functionality_storage | ✘ N/A | - | |
| personalization_storage | ✘ N/A | - | |
| security_storage | ✘ N/A | - | |
| after_necessary_only_consent | analytics_storage | ✘ N/A | - |
| ad_personalization | ✘ N/A | - | |
| ad_storage | ✘ N/A | ✔ N/A | |
| ad_user_data | ✘ N/A | - | |
| functionality_storage | ✘ N/A | - | |
| personalization_storage | ✘ N/A | - | |
| security_storage | ✘ N/A | - |
| Google Consent Mode | Bing Ads Consent Mode | |
| before_consent | ||
| analytics_storage | ✘ N/A | - |
| ad_personalization | ✘ N/A | - |
| ad_storage | ✘ N/A | ✔ N/A |
| ad_user_data | ✘ N/A | - |
| functionality_storage | ✘ N/A | - |
| personalization_storage | ✘ N/A | - |
| security_storage | ✘ N/A | - |
| after_accept_all_consent | ||
| analytics_storage | ✘ N/A | - |
| ad_personalization | ✘ N/A | - |
| ad_storage | ✘ N/A | ✔ N/A |
| ad_user_data | ✘ N/A | - |
| functionality_storage | ✘ N/A | - |
| personalization_storage | ✘ N/A | - |
| security_storage | ✘ N/A | - |
| after_necessary_only_consent | ||
| analytics_storage | ✘ N/A | - |
| ad_personalization | ✘ N/A | - |
| ad_storage | ✘ N/A | ✔ N/A |
| ad_user_data | ✘ N/A | - |
| functionality_storage | ✘ N/A | - |
| personalization_storage | ✘ N/A | - |
| security_storage | ✘ N/A | - |
|
|
| compliancy_score | 9542 |
| tracking_ | 0 |
| tracking_ | 0 |
| google_ | -90 |
| google_ | -30 |
| google_ | 0 |
| google_ | -35 |
| google_ | -16 |
| bing_ | 0 |
| tracking_ | -30 |
| tracking_ | -30 |
| tracking_ | -60 |
| tracking_ | 0 |
| third_ | 0 |
| third_ | 0 |
| third_ | -17 |
| third_ | 0 |
| third_ | 0 |
| persistent_ | -40 |
| cookies_ | -66 |
| cookies_ | -14 |
| requests_ | -30 |
|
Before Consent:
|
After Accept All Consent:
|
After Necessary Only Consent:
|
{
"scrape_request_details" : {
"status" : "success",
"url" : "https://sercom.eu",
"url_tld" : ".eu",
"request_id" : "2025-11-19-00-32-35-Mu06O9Rnp394Bo37dNPk",
"request_options" : "",
"output_options_include_only" : "",
"output_options_exclude" : "",
"api_key_account_id" : null,
"scraper_location" : "eu",
"scraper_location_continent" : "EU",
"scraper_location_country" : "Netherlands",
"scraper" : "https://extreme-scraping-api.com",
"utc_date" : "2025-11-19",
"utc_time" : "00:32:35",
"utc_timestamp" : 1763512355,
"category_based_on_words_on_page_by_ai" : "Food",
"favicon" : "https://screenshots.extreme-scraping-api.com/Favicon_2025-11-19-00-32-35-Mu06O9Rnp394Bo37dNPk.png",
"screenshot_before_consent" : "https://screenshots.extreme-scraping-api.com/Screenshot_2025-11-19-00-32-35-Mu06O9Rnp394Bo37dNPk_before_consent.webp",
"screenshot_after_accept_all_consent" : "https://screenshots.extreme-scraping-api.com/Screenshot_2025-11-19-00-32-35-Mu06O9Rnp394Bo37dNPk_after_accept_all_consent.webp",
"screenshot_after_necessary_only_consent" : "https://screenshots.extreme-scraping-api.com/Screenshot_2025-11-19-00-32-35-Mu06O9Rnp394Bo37dNPk_after_necessary_only_consent.webp"
},
"page_info_og_tags" : {
"category_based_on_words_on_page_by_ai" : "Food",
"top_25_nouns" : "skovsercom products contact sector automation bulb computers farming flower process storage accessory arable back builds chicory click cold company conditions cookies customers device electronics emailcontact",
"title" : "SKOV-SERCOM B.V. | Horti Climate Solutions",
"description" : "SKOV-SERCOM builds electronics and computers for process automation. We are specialised in various sectors, e.g. horticulture and flower bulbs.",
"og:locale" : "en_GB",
"og:locale:alternate" : "pl_PL",
"og:type" : "website",
"og:title" : "SKOV-SERCOM B.V. | Horti Climate Solutions",
"og:description" : "SKOV-SERCOM builds electronics and computers for process automation. We are specialised in various sectors, e.g. horticulture and flower bulbs.",
"og:url" : "https://www.sercom.eu/en/homepage/",
"og:site_name" : "SKOV-SERCOM B.V.",
"og:image" : "https://www.sercom.eu/wp-content/uploads/2020/11/Header2-©-Lisanne-Mesman.jpg",
"og:image:width" : "1920",
"og:image:height" : "250",
"og:image:type" : "image/jpeg"
},
"cookiebanner" : {
"found" : true,
"name" : "Complianz",
"found_accept_all_button" : true,
"found_necessary_only_button" : true,
"google_consent_mode_version" : "not_found",
"google_consent_mode_v2_basic_mode_found" : false,
"google_consent_mode_v2_advanced_mode_found" : false,
"google_consent_mode_v2_misconfiguration_found" : false,
"bing_ads_uet_consent_mode" : "not_found"
},
"compliancy_score_stats" : {
"scores" : {
"tracking_pixels_found_but_no_cookiebanner" : 0,
"tracking_pixels_found_but_no_necessary_only_consent_button" : 0,
"google_requests_found_but_no_google_consent_mode_found" : -90,
"google_analytics_pixels_found_before_consent" : -30,
"google_consent_mode_advanced_mode_misconfigured" : 0,
"google_consent_mode_basic_mode_misconfigured" : -35,
"google_requests_found_before_consent" : -16,
"bing_ads_found_without_uet_consent_mode" : 0,
"tracking_pixels_found_before_consent" : -30,
"tracking_pixels_found_after_necessary_only_consent" : -30,
"tracking_cookies_found_before_consent" : -60,
"tracking_cookies_found_after_necessary_only_consent" : 0,
"third_party_cookies_found_before_consent" : 0,
"third_party_cookies_found_after_necessary_only_consent" : 0,
"third_party_tags_found_before_consent" : -17,
"third_party_tags_persistent_cookies_with_id_found_before_consent" : 0,
"third_party_tags_persistent_cookies_with_id_found_after_accept_all_consent" : 0,
"persistent_cookies_with_id_found_before_consent" : -40,
"cookies_found_from_third_party_tags_before_consent" : -66,
"cookies_found_from_third_party_tags_after_accept_all_consent" : -14,
"requests_found_from_europe_and_usa_mixed" : -30
},
"compliancy_score" : 9542
},
"stats_flat_view" : {
"stats__compliancy_score" : 9542,
"stats__cookiebanner__found" : 1,
"stats__cookiebanner__accept_all_button__found" : 1,
"stats__cookiebanner__necessary_only_button__found" : 1,
"stats__google_consent_mode_v2__found" : 0,
"stats__google_consent_mode_v2__basic_mode__found" : 0,
"stats__google_consent_mode_v2__advanced_mode__found" : 0,
"stats__google_consent_mode_v2__misconfiguration__found" : 0,
"stats__bing_ads__uet_consent_mode_v1__found" : 0,
"stats__bing_ads__uet_consent_mode_v1__misconfiguration_found" : 0,
"stats__bing_ads__found__full_consent" : 0,
"stats__bing_ads__found__necessary_consent" : 0,
"stats__google_analytics_pixels_found__full_consent__before_consent" : 1,
"stats__google_analytics_pixels_found__full_consent__after_accept_all_consent" : 1,
"stats__google_analytics_pixels_found__full_consent__total" : 2,
"stats__google_analytics_pixels_found__necessary_consent__before_consent" : 1,
"stats__google_analytics_pixels_found__necessary_consent__after_necessary_only_consent" : 1,
"stats__google_analytics_pixels_found__necessary_consent__total" : 2,
"stats__google_analytics_pixels_found__google_consent_mode_v2__advanced_mode__full_consent__before_consent__valid" : 0,
"stats__google_analytics_pixels_found__google_consent_mode_v2__advanced_mode__full_consent__after_accept_all_consent__valid" : 0,
"stats__google_analytics_pixels_found__google_consent_mode_v2__advanced_mode__full_consent__after_accept_all_consent__misconfigured" : 0,
"stats__google_analytics_pixels_found__google_consent_mode_v2__advanced_mode__necessary_consent__before_consent__valid" : 0,
"stats__google_analytics_pixels_found__google_consent_mode_v2__advanced_mode__necessary_consent__after_necessary_only_consent__valid" : 0,
"stats__google_analytics_pixels_found__google_consent_mode_v2__basic_mode__full_consent__before_consent__misconfigured" : 1,
"stats__google_analytics_pixels_found__google_consent_mode_v2__basic_mode__full_consent__after_accept_all_consent__valid" : 0,
"stats__google_analytics_pixels_found__google_consent_mode_v2__basic_mode__necessary_consent__before_consent__misconfigured" : 1,
"stats__google_analytics_pixels_found__google_consent_mode_v2__basic_mode__necessary_consent__after_necessary_only_consent__misconfigured" : 0,
"stats__google_ads_pixels_found__full_consent__before_consent" : 0,
"stats__google_ads_pixels_found__full_consent__after_accept_all_consent" : 0,
"stats__google_ads_pixels_found__full_consent__total" : 0,
"stats__google_ads_pixels_found__necessary_consent__before_consent" : 0,
"stats__google_ads_pixels_found__necessary_consent__after_necessary_only_consent" : 0,
"stats__google_ads_pixels_found__necessary_consent__total" : 0,
"stats__number_of_google_requests__full_consent__before_consent" : 4,
"stats__number_of_google_requests__full_consent__after_accept_all_consent" : 2,
"stats__number_of_google_requests__full_consent__total" : 6,
"stats__number_of_google_requests__necessary_consent__before_consent" : 4,
"stats__number_of_google_requests__necessary_consent__after_necessary_only_consent" : 1,
"stats__number_of_google_requests__necessary_consent__total" : 5,
"stats__number_of_tracking_pixels__full_consent__before_consent" : 1,
"stats__number_of_tracking_pixels__full_consent__after_accept_all_consent" : 1,
"stats__number_of_tracking_pixels__full_consent__total" : 2,
"stats__number_of_tracking_pixels__necessary_consent__before_consent" : 1,
"stats__number_of_tracking_pixels__necessary_consent__after_necessary_only_consent" : 1,
"stats__number_of_tracking_pixels__necessary_consent__total" : 2,
"stats__number_of_tracking_cookies__full_consent__before_consent" : 2,
"stats__number_of_tracking_cookies__full_consent__after_accept_all_consent" : 0,
"stats__number_of_tracking_cookies__full_consent__total" : 2,
"stats__number_of_tracking_cookies__necessary_consent__before_consent" : 2,
"stats__number_of_tracking_cookies__necessary_consent__after_necessary_only_consent" : 0,
"stats__number_of_tracking_cookies__necessary_consent__total" : 2,
"stats__number_of_first_party_cookies__full_consent__before_consent" : 4,
"stats__number_of_first_party_cookies__full_consent__after_accept_all_consent" : 7,
"stats__number_of_first_party_cookies__full_consent__total" : 11,
"stats__number_of_first_party_cookies__necessary_consent__before_consent" : 4,
"stats__number_of_first_party_cookies__necessary_consent__after_necessary_only_consent" : 7,
"stats__number_of_first_party_cookies__necessary_consent__total" : 11,
"stats__number_of_third_party_cookies__full_consent__before_consent" : 0,
"stats__number_of_third_party_cookies__full_consent__after_accept_all_consent" : 0,
"stats__number_of_third_party_cookies__full_consent__total" : 0,
"stats__number_of_third_party_cookies__necessary_consent__before_consent" : 0,
"stats__number_of_third_party_cookies__necessary_consent__after_necessary_only_consent" : 0,
"stats__number_of_third_party_cookies__necessary_consent__total" : 0,
"stats__number_of_third_party_tags__full_consent__main_tags__before_consent" : 4,
"stats__number_of_third_party_tags__full_consent__main_tags__after_accept_all_consent" : 1,
"stats__number_of_third_party_tags__full_consent__total_requests__before_consent" : 17,
"stats__number_of_third_party_tags__full_consent__total_requests__after_accept_all_consent" : 2,
"stats__number_of_third_party_tags__full_consent__cookies__before_consent" : 2,
"stats__number_of_third_party_tags__full_consent__cookies__after_accept_all_consent" : 7,
"stats__number_of_third_party_tags__necessary_consent__main_tags__before_consent" : 4,
"stats__number_of_third_party_tags__necessary_consent__main_tags__after_necessary_only_consent" : 0,
"stats__number_of_third_party_tags__necessary_consent__total_requests__before_consent" : 16,
"stats__number_of_third_party_tags__necessary_consent__total_requests__after_necessary_only_consent" : 1,
"stats__number_of_third_party_tags__necessary_consent__cookies__before_consent" : 2,
"stats__number_of_third_party_tags__necessary_consent__cookies__after_necessary_only_consent" : 7,
"stats__number_of_persistent_cookies_with_id__full_consent__local_or_unknown__before_consent" : 2,
"stats__number_of_persistent_cookies_with_id__full_consent__local_or_unknown__after_accept_all_consent" : 0,
"stats__number_of_persistent_cookies_with_id__full_consent__from_third_party_tags__before_consent" : 0,
"stats__number_of_persistent_cookies_with_id__full_consent__from_third_party_tags__after_accept_all_consent" : 0,
"stats__number_of_persistent_cookies_with_id__full_consent__total__before_consent" : 2,
"stats__number_of_persistent_cookies_with_id__full_consent__total__after_accept_all_consent" : 0,
"stats__number_of_persistent_cookies_with_id__full_consent__total" : 2,
"stats__number_of_persistent_cookies_with_id__necessary_consent__local_or_unknown__before_consent" : 2,
"stats__number_of_persistent_cookies_with_id__necessary_consent__local_or_unknown__after_necessary_only_consent" : 0,
"stats__number_of_persistent_cookies_with_id__necessary_consent__from_third_party_tags__before_consent" : 0,
"stats__number_of_persistent_cookies_with_id__necessary_consent__from_third_party_tags__after_necessary_only_consent" : 0,
"stats__number_of_persistent_cookies_with_id__necessary_consent__total__before_consent" : 2,
"stats__number_of_persistent_cookies_with_id__necessary_consent__total__after_necessary_only_consent" : 0,
"stats__number_of_persistent_cookies_with_id__necessary_consent__total" : 2,
"stats__number_of_all_cookies__full_consent__local_or_unknown__before_consent" : 2,
"stats__number_of_all_cookies__full_consent__local_or_unknown__after_accept_all_consent" : 0,
"stats__number_of_all_cookies__full_consent__from_third_party_tags__before_consent" : 2,
"stats__number_of_all_cookies__full_consent__from_third_party_tags__after_accept_all_consent" : 7,
"stats__number_of_all_cookies__full_consent__total__before_consent" : 4,
"stats__number_of_all_cookies__full_consent__total__after_accept_all_consent" : 7,
"stats__number_of_all_cookies__full_consent__total" : 11,
"stats__number_of_all_cookies__necessary_consent__local_or_unknown__before_consent" : 2,
"stats__number_of_all_cookies__necessary_consent__local_or_unknown__after_necessary_only_consent" : 0,
"stats__number_of_all_cookies__necessary_consent__from_third_party_tags__before_consent" : 2,
"stats__number_of_all_cookies__necessary_consent__from_third_party_tags__after_necessary_only_consent" : 7,
"stats__number_of_all_cookies__necessary_consent__total__before_consent" : 4,
"stats__number_of_all_cookies__necessary_consent__total__after_necessary_only_consent" : 7,
"stats__number_of_all_cookies__necessary_consent__total" : 11,
"stats__number_of_analytics_requests__full_consent__before_consent" : 3,
"stats__number_of_analytics_requests__full_consent__after_accept_all_consent" : 2,
"stats__number_of_analytics_requests__necessary_consent__before_consent" : 3,
"stats__number_of_analytics_requests__necessary_consent__after_necessary_only_consent" : 1,
"stats__number_of_marketing_requests__full_consent__before_consent" : 0,
"stats__number_of_marketing_requests__full_consent__after_accept_all_consent" : 0,
"stats__number_of_marketing_requests__necessary_consent__before_consent" : 0,
"stats__number_of_marketing_requests__necessary_consent__after_necessary_only_consent" : 0,
"stats__number_of_ads_requests__full_consent__before_consent" : 0,
"stats__number_of_ads_requests__full_consent__after_accept_all_consent" : 0,
"stats__number_of_ads_requests__necessary_consent__before_consent" : 0,
"stats__number_of_ads_requests__necessary_consent__after_necessary_only_consent" : 0,
"stats__continents__number_of_north_america_requests__full_consent__before_consent" : 1,
"stats__continents__number_of_north_america_requests__full_consent__after_accept_all_consent" : 0,
"stats__continents__number_of_north_america_requests__full_consent__total" : 1,
"stats__continents__number_of_north_america_requests__necessary_consent__before_consent" : 1,
"stats__continents__number_of_north_america_requests__necessary_consent__after_necessary_only_consent" : 0,
"stats__continents__number_of_north_america_requests__necessary_consent__total" : 1,
"stats__continents__number_of_europe_requests__full_consent__before_consent" : 73,
"stats__continents__number_of_europe_requests__full_consent__after_accept_all_consent" : 3,
"stats__continents__number_of_europe_requests__full_consent__total" : 76,
"stats__continents__number_of_europe_requests__necessary_consent__before_consent" : 72,
"stats__continents__number_of_europe_requests__necessary_consent__after_necessary_only_consent" : 1,
"stats__continents__number_of_europe_requests__necessary_consent__total" : 73,
"stats__continents__number_of_asia_requests__full_consent__before_consent" : 0,
"stats__continents__number_of_asia_requests__full_consent__after_accept_all_consent" : 0,
"stats__continents__number_of_asia_requests__full_consent__total" : 0,
"stats__continents__number_of_asia_requests__necessary_consent__before_consent" : 0,
"stats__continents__number_of_asia_requests__necessary_consent__after_necessary_only_consent" : 0,
"stats__continents__number_of_asia_requests__necessary_consent__total" : 0,
"stats__continents__number_of_south_america_requests__full_consent__before_consent" : 0,
"stats__continents__number_of_south_america_requests__full_consent__after_accept_all_consent" : 0,
"stats__continents__number_of_south_america_requests__full_consent__total" : 0,
"stats__continents__number_of_south_america_requests__necessary_consent__before_consent" : 0,
"stats__continents__number_of_south_america_requests__necessary_consent__after_necessary_only_consent" : 0,
"stats__continents__number_of_south_america_requests__necessary_consent__total" : 0,
"stats__continents__number_of_africa_requests__full_consent__before_consent" : 0,
"stats__continents__number_of_africa_requests__full_consent__after_accept_all_consent" : 0,
"stats__continents__number_of_africa_requests__full_consent__total" : 0,
"stats__continents__number_of_africa_requests__necessary_consent__before_consent" : 0,
"stats__continents__number_of_africa_requests__necessary_consent__after_necessary_only_consent" : 0,
"stats__continents__number_of_africa_requests__necessary_consent__total" : 0,
"stats__continents__number_of_oceania_requests__full_consent__before_consent" : 0,
"stats__continents__number_of_oceania_requests__full_consent__after_accept_all_consent" : 0,
"stats__continents__number_of_oceania_requests__full_consent__total" : 0,
"stats__continents__number_of_oceania_requests__necessary_consent__before_consent" : 0,
"stats__continents__number_of_oceania_requests__necessary_consent__after_necessary_only_consent" : 0,
"stats__continents__number_of_oceania_requests__necessary_consent__total" : 0,
"stats__number_of_all_requests__full_consent__before_consent" : 80,
"stats__number_of_all_requests__full_consent__after_accept_all_consent" : 3,
"stats__number_of_all_requests__full_consent__total" : 83,
"stats__number_of_all_requests__necessary_consent__before_consent" : 79,
"stats__number_of_all_requests__necessary_consent__after_necessary_only_consent" : 1,
"stats__number_of_all_requests__necessary_consent__total" : 80,
"stats__total_content_length_bytes__all_requests__full_consent__before_consent" : 2567134,
"stats__total_content_length_bytes__all_requests__full_consent__after_accept_all_consent" : 147342,
"stats__total_content_length_bytes__all_requests__full_consent__total" : 2714476,
"stats__total_content_length_bytes__all_requests__necessary_consent__before_consent" : 2577289,
"stats__total_content_length_bytes__all_requests__necessary_consent__after_necessary_only_consent" : 0,
"stats__total_content_length_bytes__all_requests__necessary_consent__total" : 2577289,
"stats__total_network_transferring_time_msec__all_requests__full_consent__before_consent" : 2095,
"stats__total_network_transferring_time_msec__all_requests__full_consent__after_accept_all_consent" : 129,
"stats__total_network_transferring_time_msec__all_requests__full_consent__total" : 2224,
"stats__total_network_transferring_time_msec__all_requests__necessary_consent__before_consent" : 2075,
"stats__total_network_transferring_time_msec__all_requests__necessary_consent__after_necessary_only_consent" : 17,
"stats__total_network_transferring_time_msec__all_requests__necessary_consent__total" : 2092,
"stats__http_response_status_codes__all_requests__full_consent__200s" : 82,
"stats__http_response_status_codes__all_requests__full_consent__300s" : 0,
"stats__http_response_status_codes__all_requests__full_consent__400s" : 1,
"stats__http_response_status_codes__all_requests__full_consent__500s" : 0,
"stats__http_protocol_versions__all_requests__full_consent__h3" : 10,
"stats__http_protocol_versions__all_requests__full_consent__h2" : 67,
"stats__http_protocol_versions__all_requests__full_consent__http_1_1" : 0,
"stats__http_protocol_versions__all_requests__full_consent__http_1_0" : 0,
"stats__http_protocol_versions__all_requests__full_consent__data" : 6,
"stats__http_protocol_versions__all_requests__full_consent__blob" : 0,
"stats__security_protocol_versions__all_requests__full_consent__quic" : 10,
"stats__security_protocol_versions__all_requests__full_consent__tls_1_3" : 67,
"stats__security_protocol_versions__all_requests__full_consent__tls_1_2" : 0,
"stats__selectors__number_of_hrefs__full_consent" : 81,
"stats__selectors__number_of_imgs__full_consent" : 38,
"stats__selectors__number_of_buttons__full_consent" : 0,
"stats__selectors__number_of_forms__full_consent" : 2,
"stats__selectors__number_of_headings__full_consent" : 6,
"stats__selectors__number_of_paragraphs__full_consent" : 12,
"stats__number_of_words__full_consent" : 119
},
"third_party_tags_by_consent_flat_view" : [
{
"Tag" : "AddToAny Widgets",
"Full_Consent" : [
"before_consent main_tag_1 : https://static.addtoany.com/menu/page.js",
"before_consent other_1 : https://static.addtoany.com/menu/sm.25.html",
"before_consent other_2 : https://static.addtoany.com/menu/modules/core.oafg07ee.js",
"before_consent other_3 : https://static.addtoany.com/cdn-cgi/speculation",
"before_consent other_4 : https://static.addtoany.com/menu/svg/icons/a2a.js"
],
"Necessary_Consent" : [
"before_consent main_tag_1 : https://static.addtoany.com/menu/page.js",
"before_consent other_1 : https://static.addtoany.com/menu/sm.25.html",
"before_consent other_2 : https://static.addtoany.com/menu/modules/core.oafg07ee.js",
"before_consent other_3 : https://static.addtoany.com/menu/svg/icons/a2a.js"
]
},
{
"Tag" : "Google Tag Manager",
"Full_Consent" : [
"before_consent main_tag_1 : https://www.googletagmanager.com/gtm.js?id=GTM-KBWRQGK"
],
"Necessary_Consent" : [
"before_consent main_tag_1 : https://www.googletagmanager.com/gtm.js?id=GTM-KBWRQGK"
]
},
{
"Tag" : "Google Analytics 4",
"Full_Consent" : [
"before_consent main_tag_1 : https://www.googletagmanager.com/gtag/js?id=G-PH4HET5CSQ&cx=c>m=4e5bh1",
"before_consent main_tag_2 : https://www.googletagmanager.com/gtag/js?id=G-VW4CQMPE4W&cx=c>m=4e5bh1",
"before_consent pixel_1 : https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bh1v899625038za200zb843174642zd843174642&_p=1763512357937&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=1926542854.1763512358&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_s=1&tag_exp=103116026~103200004~104527907~104528500~104684208~104684211~115583767~115938466~115938469~116217636~116217638~116474637&sid=1763512358&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=page_view&_fv=1&_nsi=1&_ss=1&_ee=1&tfd=701",
"before_consent cookie_1 : first_party_cookie: _ga = GA1.1.1926542854.1763512358",
"before_consent cookie_2 : first_party_cookie: _ga_VW4CQMPE4W = GS2.1.s1763512358$o1$g0$t1763512358$j60$l0$h0",
"after_accept_all_consent main_tag_3 : https://www.googletagmanager.com/gtag/js?id=G-VW4CQMPE4W",
"after_accept_all_consent pixel_2 : https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bh1v899625038za200zb843174642zd843174642&_p=1763512357937&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=1926542854.1763512358&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_eu=AEAAAAQ&_s=2&tag_exp=103116026~103200004~104527907~104528500~104684208~104684211~115583767~115938466~115938469~116217636~116217638~116474637&sid=1763512358&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=scroll&epn.percent_scrolled=90&tfd=5734"
],
"Necessary_Consent" : [
"before_consent main_tag_1 : https://www.googletagmanager.com/gtag/js?id=G-PH4HET5CSQ&cx=c>m=4e5bi0h2",
"before_consent main_tag_2 : https://www.googletagmanager.com/gtag/js?id=G-VW4CQMPE4W&cx=c>m=4e5bi0h2",
"before_consent pixel_1 : https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bi0h2v899625038za200zb843174642zd843174642&_p=1763512364905&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=22695101.1763512365&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_s=1&tag_exp=103116026~103200004~104527906~104528500~104684208~104684211~115583767~115938466~115938469~115985661~116217636~116217638&sid=1763512365&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=page_view&_fv=1&_nsi=1&_ss=1&_ee=1&tfd=671",
"before_consent cookie_1 : first_party_cookie: _ga = GA1.1.22695101.1763512365",
"before_consent cookie_2 : first_party_cookie: _ga_VW4CQMPE4W = GS2.1.s1763512365$o1$g0$t1763512365$j60$l0$h0",
"after_necessary_only_consent pixel_2 : https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bi0h2v899625038za200zb843174642zd843174642&_p=1763512364905&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=22695101.1763512365&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_eu=AEAAAAQ&_s=2&tag_exp=103116026~103200004~104527906~104528500~104684208~104684211~115583767~115938466~115938469~115985661~116217636~116217638&sid=1763512365&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=scroll&epn.percent_scrolled=90&tfd=5680"
]
},
{
"Tag" : "Complianz Cookiebanner",
"Full_Consent" : [
"after_accept_all_consent cookie_1 : first_party_cookie: cmplz_consented_services = ",
"after_accept_all_consent cookie_2 : first_party_cookie: cmplz_policy_id = 30",
"after_accept_all_consent cookie_3 : first_party_cookie: cmplz_marketing = allow",
"after_accept_all_consent cookie_4 : first_party_cookie: cmplz_statistics = allow",
"after_accept_all_consent cookie_5 : first_party_cookie: cmplz_preferences = allow",
"after_accept_all_consent cookie_6 : first_party_cookie: cmplz_functional = allow",
"after_accept_all_consent cookie_7 : first_party_cookie: cmplz_banner-status = dismissed"
],
"Necessary_Consent" : [
"after_necessary_only_consent cookie_1 : first_party_cookie: cmplz_banner-status = dismissed",
"after_necessary_only_consent cookie_2 : first_party_cookie: cmplz_policy_id = 30",
"after_necessary_only_consent cookie_3 : first_party_cookie: cmplz_marketing = deny",
"after_necessary_only_consent cookie_4 : first_party_cookie: cmplz_statistics = deny",
"after_necessary_only_consent cookie_5 : first_party_cookie: cmplz_preferences = deny",
"after_necessary_only_consent cookie_6 : first_party_cookie: cmplz_functional = allow",
"after_necessary_only_consent cookie_7 : first_party_cookie: cmplz_consented_services = "
]
}
],
"stats_country_requests" : {
"full_consent__before_consent" : {
"north_america" : {
"us" : "1"
},
"europe" : {
"nl" : "70",
"ie" : "3"
}
},
"full_consent__after_accept_all_consent" : {
"europe" : {
"ie" : "2",
"nl" : "1"
}
},
"necessary_consent__before_consent" : {
"north_america" : {
"us" : "1"
},
"europe" : {
"nl" : "69",
"ie" : "3"
}
},
"necessary_consent__after_necessary_only_consent" : {
"europe" : {
"nl" : "1"
}
}
},
"stats_nested_view" : {
"compliancy_score" : 9542,
"cookiebanner" : {
"found" : 1,
"accept_all_button_found" : 1,
"necessary_only_button_found" : 1
},
"google_consent_mode_v2" : {
"found" : 0,
"basic_mode_found" : 0,
"advanced_mode_found" : 0,
"misconfiguration_found" : 0
},
"bing_ads" : {
"uet_consent_mode_v1" : {
"found" : 0,
"misconfiguration_found" : 0
},
"found" : {
"full_consent" : 0,
"necessary_consent" : 0
}
},
"google_analytics_pixels_found" : {
"full_consent" : {
"before_consent" : 1,
"after_accept_all_consent" : 1,
"total" : 2
},
"necessary_consent" : {
"before_consent" : 1,
"after_necessary_only_consent" : 1,
"total" : 2
},
"google_consent_mode_v2" : {
"advanced_mode" : {
"full_consent" : {
"before_consent" : {
"valid" : 0
},
"after_accept_all_consent" : {
"valid" : 0,
"misconfigured" : 0
}
},
"necessary_consent" : {
"before_consent" : {
"valid" : 0
},
"after_necessary_only_consent" : {
"valid" : 0
}
}
},
"basic_mode" : {
"full_consent" : {
"before_consent" : {
"misconfigured" : 1
},
"after_accept_all_consent" : {
"valid" : 0
}
},
"necessary_consent" : {
"before_consent" : {
"misconfigured" : 1
},
"after_necessary_only_consent" : {
"misconfigured" : 0
}
}
}
}
},
"google_ads_pixels_found" : {
"full_consent" : {
"before_consent" : 0,
"after_accept_all_consent" : 0,
"total" : 0
},
"necessary_consent" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0,
"total" : 0
}
},
"number_of_google_requests" : {
"full_consent" : {
"before_consent" : 4,
"after_accept_all_consent" : 2,
"total" : 6
},
"necessary_consent" : {
"before_consent" : 4,
"after_necessary_only_consent" : 1,
"total" : 5
}
},
"number_of_tracking_pixels" : {
"full_consent" : {
"before_consent" : 1,
"after_accept_all_consent" : 1,
"total" : 2
},
"necessary_consent" : {
"before_consent" : 1,
"after_necessary_only_consent" : 1,
"total" : 2
}
},
"number_of_tracking_cookies" : {
"full_consent" : {
"before_consent" : 2,
"after_accept_all_consent" : 0,
"total" : 2
},
"necessary_consent" : {
"before_consent" : 2,
"after_necessary_only_consent" : 0,
"total" : 2
}
},
"number_of_first_party_cookies" : {
"full_consent" : {
"before_consent" : 4,
"after_accept_all_consent" : 7,
"total" : 11
},
"necessary_consent" : {
"before_consent" : 4,
"after_necessary_only_consent" : 7,
"total" : 11
}
},
"number_of_third_party_cookies" : {
"full_consent" : {
"before_consent" : 0,
"after_accept_all_consent" : 0,
"total" : 0
},
"necessary_consent" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0,
"total" : 0
}
},
"number_of_third_party_tags" : {
"full_consent" : {
"main_tags" : {
"before_consent" : 4,
"after_accept_all_consent" : 1
},
"total_requests" : {
"before_consent" : 17,
"after_accept_all_consent" : 2
},
"cookies" : {
"before_consent" : 2,
"after_accept_all_consent" : 7
}
},
"necessary_consent" : {
"main_tags" : {
"before_consent" : 4,
"after_necessary_only_consent" : 0
},
"total_requests" : {
"before_consent" : 16,
"after_necessary_only_consent" : 1
},
"cookies" : {
"before_consent" : 2,
"after_necessary_only_consent" : 7
}
}
},
"number_of_persistent_cookies_with_id" : {
"full_consent" : {
"local_or_unknown" : {
"before_consent" : 2,
"after_accept_all_consent" : 0
},
"from_third_party_tags" : {
"before_consent" : 0,
"after_accept_all_consent" : 0
},
"total" : 2
},
"necessary_consent" : {
"local_or_unknown" : {
"before_consent" : 2,
"after_necessary_only_consent" : 0
},
"from_third_party_tags" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0
},
"total" : 2
}
},
"number_of_all_cookies" : {
"full_consent" : {
"local_or_unknown" : {
"before_consent" : 2,
"after_accept_all_consent" : 0
},
"from_third_party_tags" : {
"before_consent" : 2,
"after_accept_all_consent" : 7
},
"total" : 11
},
"necessary_consent" : {
"local_or_unknown" : {
"before_consent" : 2,
"after_necessary_only_consent" : 0
},
"from_third_party_tags" : {
"before_consent" : 2,
"after_necessary_only_consent" : 7
},
"total" : 11
}
},
"number_of_analytics_requests" : {
"full_consent" : {
"before_consent" : 3,
"after_accept_all_consent" : 2
},
"necessary_consent" : {
"before_consent" : 3,
"after_necessary_only_consent" : 1
}
},
"number_of_marketing_requests" : {
"full_consent" : {
"before_consent" : 0,
"after_accept_all_consent" : 0
},
"necessary_consent" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0
}
},
"number_of_ads_requests" : {
"full_consent" : {
"before_consent" : 0,
"after_accept_all_consent" : 0
},
"necessary_consent" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0
}
},
"continents" : {
"number_of_north_america_requests" : {
"full_consent" : {
"before_consent" : 1,
"after_accept_all_consent" : 0,
"total" : 1
},
"necessary_consent" : {
"before_consent" : 1,
"after_necessary_only_consent" : 0,
"total" : 1
}
},
"number_of_europe_requests" : {
"full_consent" : {
"before_consent" : 73,
"after_accept_all_consent" : 3,
"total" : 76
},
"necessary_consent" : {
"before_consent" : 72,
"after_necessary_only_consent" : 1,
"total" : 73
}
},
"number_of_asia_requests" : {
"full_consent" : {
"before_consent" : 0,
"after_accept_all_consent" : 0,
"total" : 0
},
"necessary_consent" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0,
"total" : 0
}
},
"number_of_south_america_requests" : {
"full_consent" : {
"before_consent" : 0,
"after_accept_all_consent" : 0,
"total" : 0
},
"necessary_consent" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0,
"total" : 0
}
},
"number_of_africa_requests" : {
"full_consent" : {
"before_consent" : 0,
"after_accept_all_consent" : 0,
"total" : 0
},
"necessary_consent" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0,
"total" : 0
}
},
"number_of_oceania_requests" : {
"full_consent" : {
"before_consent" : 0,
"after_accept_all_consent" : 0,
"total" : 0
},
"necessary_consent" : {
"before_consent" : 0,
"after_necessary_only_consent" : 0,
"total" : 0
}
}
},
"number_of_all_requests" : {
"full_consent" : {
"before_consent" : 80,
"after_accept_all_consent" : 3,
"total" : 83
},
"necessary_consent" : {
"before_consent" : 79,
"after_necessary_only_consent" : 1,
"total" : 80
}
},
"total_content_length_bytes" : {
"all_requests" : {
"full_consent" : {
"before_consent" : 2567134,
"after_accept_all_consent" : 147342,
"total" : 2714476
},
"necessary_consent" : {
"before_consent" : 2577289,
"after_necessary_only_consent" : 0,
"total" : 2577289
}
}
},
"total_network_transferring_time_msec" : {
"all_requests" : {
"full_consent" : {
"before_consent" : 2095,
"after_accept_all_consent" : 129,
"total" : 2224
},
"necessary_consent" : {
"before_consent" : 2075,
"after_necessary_only_consent" : 17,
"total" : 2092
}
}
},
"http_response_status_codes" : {
"all_requests" : {
"full_consent" : {
"200s" : 82,
"300s" : 0,
"400s" : 1,
"500s" : 0
}
}
},
"http_protocol_versions" : {
"all_requests" : {
"full_consent" : {
"h3" : 10,
"h2" : 67,
"http_1_1" : 0,
"http_1_0" : 0,
"data" : 6,
"blob" : 0
}
}
},
"security_protocol_versions" : {
"all_requests" : {
"full_consent" : {
"quic" : 10,
"tls_1_3" : 67,
"tls_1_2" : 0
}
}
},
"selectors" : {
"number_of_hrefs" : {
"full_consent" : 81
},
"number_of_imgs" : {
"full_consent" : 38
},
"number_of_buttons" : {
"full_consent" : 0
},
"number_of_forms" : {
"full_consent" : 2
},
"number_of_headings" : {
"full_consent" : 6
},
"number_of_paragraphs" : {
"full_consent" : 12
}
},
"number_of_words" : {
"full_consent" : 119
}
},
"third_party_tags_by_consent_nested_view" : [
{
"google_consent_mode_version" : "no_gcm_found",
"type" : "google_consent_mode"
},
{
"bing_ads_uet_consent_mode_version" : "no_uetcm_found",
"type" : "bing_ads_uet_consent_mode",
"full_consent" : [
{
"consent" : "before_consent",
"parameter" : "ad_storage",
"state" : "not_set"
},
{
"consent" : "after_accept_all_consent",
"parameter" : "ad_storage",
"state" : null
}
],
"necessary_consent" : [
{
"consent" : "before_consent",
"parameter" : "ad_storage",
"state" : "not_set"
},
{
"consent" : "after_necessary_only_consent",
"parameter" : "ad_storage",
"state" : null
}
]
},
{
"tag" : "AddToAny Widgets",
"type" : "tag",
"full_consent" : [
{
"consent" : "before_consent",
"type" : "main_tag",
"request" : "https://static.addtoany.com/menu/page.js",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 660.521823048592
},
{
"consent" : "before_consent",
"type" : "other",
"request" : "https://static.addtoany.com/menu/sm.25.html",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 740.485239982605
},
{
"consent" : "before_consent",
"type" : "other",
"request" : "https://static.addtoany.com/menu/modules/core.oafg07ee.js",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 771.320572972298
},
{
"consent" : "before_consent",
"type" : "other",
"request" : "https://static.addtoany.com/cdn-cgi/speculation",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 798.316258072853
},
{
"consent" : "before_consent",
"type" : "other",
"request" : "https://static.addtoany.com/menu/svg/icons/a2a.js",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 841.013159990311
}
],
"necessary_consent" : [
{
"consent" : "before_consent",
"type" : "main_tag",
"request" : "https://static.addtoany.com/menu/page.js",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 677.122779011726
},
{
"consent" : "before_consent",
"type" : "other",
"request" : "https://static.addtoany.com/menu/sm.25.html",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 765.378588914871
},
{
"consent" : "before_consent",
"type" : "other",
"request" : "https://static.addtoany.com/menu/modules/core.oafg07ee.js",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 785.475852966309
},
{
"consent" : "before_consent",
"type" : "other",
"request" : "https://static.addtoany.com/menu/svg/icons/a2a.js",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 875.851463913918
}
]
},
{
"tag" : "Google Tag Manager",
"type" : "tag",
"full_consent" : [
{
"consent" : "before_consent",
"type" : "main_tag",
"request" : "https://www.googletagmanager.com/gtm.js?id=GTM-KBWRQGK",
"served_from_continent" : "Europe",
"served_from_country" : "Ireland",
"served_from_continent_code" : "eu",
"served_from_country_code" : "ie",
"wall_time_msec" : 772.024134039879
}
],
"necessary_consent" : [
{
"consent" : "before_consent",
"type" : "main_tag",
"request" : "https://www.googletagmanager.com/gtm.js?id=GTM-KBWRQGK",
"served_from_continent" : "Europe",
"served_from_country" : "Ireland",
"served_from_continent_code" : "eu",
"served_from_country_code" : "ie",
"wall_time_msec" : 810.097839951515
}
]
},
{
"tag" : "Google Analytics 4",
"type" : "tag",
"full_consent" : [
{
"consent" : "before_consent",
"type" : "main_tag",
"request" : "https://www.googletagmanager.com/gtag/js?id=G-PH4HET5CSQ&cx=c>m=4e5bh1",
"served_from_continent" : "Europe",
"served_from_country" : "Ireland",
"served_from_continent_code" : "eu",
"served_from_country_code" : "ie",
"wall_time_msec" : 870.419555068016
},
{
"consent" : "before_consent",
"type" : "main_tag",
"request" : "https://www.googletagmanager.com/gtag/js?id=G-VW4CQMPE4W&cx=c>m=4e5bh1",
"served_from_continent" : "Europe",
"served_from_country" : "Ireland",
"served_from_continent_code" : "eu",
"served_from_country_code" : "ie",
"wall_time_msec" : 998.85893201828
},
{
"consent" : "before_consent",
"type" : "pixel",
"request" : "https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bh1v899625038za200zb843174642zd843174642&_p=1763512357937&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=1926542854.1763512358&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_s=1&tag_exp=103116026~103200004~104527907~104528500~104684208~104684211~115583767~115938466~115938469~116217636~116217638~116474637&sid=1763512358&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=page_view&_fv=1&_nsi=1&_ss=1&_ee=1&tfd=701",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 1090.39083898067
},
{
"consent" : "before_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: _ga = GA1.1.1926542854.1763512358",
"tracking_cookie" : true
},
{
"consent" : "before_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: _ga_VW4CQMPE4W = GS2.1.s1763512358$o1$g0$t1763512358$j60$l0$h0",
"tracking_cookie" : true
},
{
"consent" : "after_accept_all_consent",
"type" : "main_tag",
"request" : "https://www.googletagmanager.com/gtag/js?id=G-VW4CQMPE4W",
"served_from_continent" : "Europe",
"served_from_country" : "Ireland",
"served_from_continent_code" : "eu",
"served_from_country_code" : "ie",
"wall_time_msec" : 3221.27993702888
},
{
"consent" : "after_accept_all_consent",
"type" : "pixel",
"request" : "https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bh1v899625038za200zb843174642zd843174642&_p=1763512357937&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=1926542854.1763512358&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_eu=AEAAAAQ&_s=2&tag_exp=103116026~103200004~104527907~104528500~104684208~104684211~115583767~115938466~115938469~116217636~116217638~116474637&sid=1763512358&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=scroll&epn.percent_scrolled=90&tfd=5734",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 6109.6064530611
}
],
"necessary_consent" : [
{
"consent" : "before_consent",
"type" : "main_tag",
"request" : "https://www.googletagmanager.com/gtag/js?id=G-PH4HET5CSQ&cx=c>m=4e5bi0h2",
"served_from_continent" : "Europe",
"served_from_country" : "Ireland",
"served_from_continent_code" : "eu",
"served_from_country_code" : "ie",
"wall_time_msec" : 918.034045934677
},
{
"consent" : "before_consent",
"type" : "main_tag",
"request" : "https://www.googletagmanager.com/gtag/js?id=G-VW4CQMPE4W&cx=c>m=4e5bi0h2",
"served_from_continent" : "Europe",
"served_from_country" : "Ireland",
"served_from_continent_code" : "eu",
"served_from_country_code" : "ie",
"wall_time_msec" : 983.930882930756
},
{
"consent" : "before_consent",
"type" : "pixel",
"request" : "https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bi0h2v899625038za200zb843174642zd843174642&_p=1763512364905&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=22695101.1763512365&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_s=1&tag_exp=103116026~103200004~104527906~104528500~104684208~104684211~115583767~115938466~115938469~115985661~116217636~116217638&sid=1763512365&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=page_view&_fv=1&_nsi=1&_ss=1&_ee=1&tfd=671",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 1078.69519591331
},
{
"consent" : "before_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: _ga = GA1.1.22695101.1763512365",
"tracking_cookie" : true
},
{
"consent" : "before_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: _ga_VW4CQMPE4W = GS2.1.s1763512365$o1$g0$t1763512365$j60$l0$h0",
"tracking_cookie" : true
},
{
"consent" : "after_necessary_only_consent",
"type" : "pixel",
"request" : "https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bi0h2v899625038za200zb843174642zd843174642&_p=1763512364905&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=22695101.1763512365&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_eu=AEAAAAQ&_s=2&tag_exp=103116026~103200004~104527906~104528500~104684208~104684211~115583767~115938466~115938469~115985661~116217636~116217638&sid=1763512365&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=scroll&epn.percent_scrolled=90&tfd=5680",
"served_from_continent" : "Europe",
"served_from_country" : "Netherlands",
"served_from_continent_code" : "eu",
"served_from_country_code" : "nl",
"wall_time_msec" : 6082.30083596706
}
]
},
{
"tag" : "Complianz Cookiebanner",
"type" : "tag",
"full_consent" : [
{
"consent" : "after_accept_all_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_consented_services = ",
"tracking_cookie" : false
},
{
"consent" : "after_accept_all_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_policy_id = 30",
"tracking_cookie" : false
},
{
"consent" : "after_accept_all_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_marketing = allow",
"tracking_cookie" : false
},
{
"consent" : "after_accept_all_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_statistics = allow",
"tracking_cookie" : false
},
{
"consent" : "after_accept_all_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_preferences = allow",
"tracking_cookie" : false
},
{
"consent" : "after_accept_all_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_functional = allow",
"tracking_cookie" : false
},
{
"consent" : "after_accept_all_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_banner-status = dismissed",
"tracking_cookie" : false
}
],
"necessary_consent" : [
{
"consent" : "after_necessary_only_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_banner-status = dismissed",
"tracking_cookie" : false
},
{
"consent" : "after_necessary_only_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_policy_id = 30",
"tracking_cookie" : false
},
{
"consent" : "after_necessary_only_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_marketing = deny",
"tracking_cookie" : false
},
{
"consent" : "after_necessary_only_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_statistics = deny",
"tracking_cookie" : false
},
{
"consent" : "after_necessary_only_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_preferences = deny",
"tracking_cookie" : false
},
{
"consent" : "after_necessary_only_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_functional = allow",
"tracking_cookie" : false
},
{
"consent" : "after_necessary_only_consent",
"type" : "cookie",
"cookie" : "first_party_cookie: cmplz_consented_services = ",
"tracking_cookie" : false
}
]
}
],
"cookies" : {
"full_consent" : [
{
"cookie_name" : "boxzilla_box_55769",
"cookie_value" : "1",
"domain" : "www.sercom.eu",
"expires" : "months",
"consent" : "before_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "local_or_unknown"
},
{
"cookie_name" : "pll_language",
"cookie_value" : "en",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "before_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "local_or_unknown",
"set_by_hint" : "WordPress - Polylang"
},
{
"cookie_name" : "_ga_VW4CQMPE4W",
"cookie_value" : "GS2.1.s1763512358$o1$g0$t1763512358$j60$l0$h0",
"domain" : ".sercom.eu",
"expires" : "years",
"consent" : "before_consent",
"type" : "first_party_cookie",
"tracking_cookie" : true,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Google Analytics 4",
"set_by_tag_from_continent" : "Europe",
"set_by_tag_from_country" : "Ireland",
"set_by_tag_from_continent_code" : "eu",
"set_by_tag_from_country_code" : "ie"
},
{
"cookie_name" : "_ga",
"cookie_value" : "GA1.1.1926542854.1763512358",
"domain" : ".sercom.eu",
"expires" : "years",
"consent" : "before_consent",
"type" : "first_party_cookie",
"tracking_cookie" : true,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Google Analytics 4",
"set_by_tag_from_continent" : "Europe",
"set_by_tag_from_country" : "Ireland",
"set_by_tag_from_continent_code" : "eu",
"set_by_tag_from_country_code" : "ie"
},
{
"cookie_name" : "cmplz_consented_services",
"cookie_value" : "",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_accept_all_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_policy_id",
"cookie_value" : "30",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_accept_all_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_marketing",
"cookie_value" : "allow",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_accept_all_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_statistics",
"cookie_value" : "allow",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_accept_all_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_preferences",
"cookie_value" : "allow",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_accept_all_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_functional",
"cookie_value" : "allow",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_accept_all_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_banner-status",
"cookie_value" : "dismissed",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_accept_all_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
}
],
"necessary_consent" : [
{
"cookie_name" : "boxzilla_box_55769",
"cookie_value" : "1",
"domain" : "www.sercom.eu",
"expires" : "months",
"consent" : "before_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "local_or_unknown"
},
{
"cookie_name" : "pll_language",
"cookie_value" : "en",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "before_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "local_or_unknown",
"set_by_hint" : "WordPress - Polylang"
},
{
"cookie_name" : "_ga_VW4CQMPE4W",
"cookie_value" : "GS2.1.s1763512365$o1$g0$t1763512365$j60$l0$h0",
"domain" : ".sercom.eu",
"expires" : "years",
"consent" : "before_consent",
"type" : "first_party_cookie",
"tracking_cookie" : true,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Google Analytics 4",
"set_by_tag_from_continent" : "Europe",
"set_by_tag_from_country" : "Ireland",
"set_by_tag_from_continent_code" : "eu",
"set_by_tag_from_country_code" : "ie"
},
{
"cookie_name" : "_ga",
"cookie_value" : "GA1.1.22695101.1763512365",
"domain" : ".sercom.eu",
"expires" : "years",
"consent" : "before_consent",
"type" : "first_party_cookie",
"tracking_cookie" : true,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Google Analytics 4",
"set_by_tag_from_continent" : "Europe",
"set_by_tag_from_country" : "Ireland",
"set_by_tag_from_continent_code" : "eu",
"set_by_tag_from_country_code" : "ie"
},
{
"cookie_name" : "cmplz_banner-status",
"cookie_value" : "dismissed",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_necessary_only_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_policy_id",
"cookie_value" : "30",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_necessary_only_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_marketing",
"cookie_value" : "deny",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_necessary_only_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_statistics",
"cookie_value" : "deny",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_necessary_only_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_preferences",
"cookie_value" : "deny",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_necessary_only_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_functional",
"cookie_value" : "allow",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_necessary_only_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
},
{
"cookie_name" : "cmplz_consented_services",
"cookie_value" : "",
"domain" : "www.sercom.eu",
"expires" : "years",
"consent" : "after_necessary_only_consent",
"type" : "first_party_cookie",
"tracking_cookie" : false,
"set_by_tag_type" : "third_party_tag",
"set_by_tag_name" : "Complianz Cookiebanner",
"set_by_tag_from_continent" : null,
"set_by_tag_from_country" : null,
"set_by_tag_from_continent_code" : null,
"set_by_tag_from_country_code" : null
}
]
},
"selectors" : {
"hrefs" : [
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/cookie-policy-eu/#cmplz-manage-consent-container",
"innerText" : "Manage options"
},
{
"href" : "https://www.sercom.eu/en/cookie-policy-eu/#cmplz-cookies-overview",
"innerText" : "Manage services"
},
{
"href" : "https://www.sercom.eu/en/cookie-policy-eu/#cmplz-tcf-wrapper",
"innerText" : "Manage {vendor_count} vendors"
},
{
"href" : "https://cookiedatabase.org/tcf/purposes/",
"innerText" : "Read more about these purposes"
},
{
"href" : "https://www.sercom.eu/en/cookie-policy-eu/#cmplz-manage-consent-container",
"innerText" : "Adjust preferences"
},
{
"href" : "https://www.sercom.eu/en/cookie-policy-eu/",
"innerText" : "Cookie policy"
},
{
"href" : "https://www.sercom.eu/en/privacy-policy/",
"innerText" : "Privacy policy"
},
{
"href" : "https://www.sercom.eu/en/homepage/#",
"innerText" : "{title}"
},
{
"href" : "https://www.sercom.eu/en/homepage/#main",
"innerText" : "Skip to content"
},
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : "Home"
},
{
"href" : "https://www.sercom.eu/en/about-us/",
"innerText" : "About us"
},
{
"href" : "https://www.sercom.eu/en/service-overview/",
"innerText" : "Service"
},
{
"href" : "https://www.sercom.eu/en/news/",
"innerText" : "News"
},
{
"href" : "https://www.sercom.eu/en/contact-us/",
"innerText" : "Contact us"
},
{
"href" : "https://www.sercom.eu/en/homepage/#pll_switcher",
"innerText" : "English"
},
{
"href" : "https://www.sercom.eu/nl/startpagina/",
"innerText" : "Nederlands"
},
{
"href" : "https://www.sercom.eu/de/startseite/",
"innerText" : "Deutsch"
},
{
"href" : "https://www.sercom.eu/ru/%d0%b4%d0%be%d0%bc%d0%b0%d1%88%d0%bd%d1%8f%d1%8f-%d1%81%d1%82%d1%80%d0%b0%d0%bd%d0%b8%d1%86%d0%b0/",
"innerText" : "Русский"
},
{
"href" : "https://www.sercom.eu/es/inicio/",
"innerText" : "Español"
},
{
"href" : "https://www.sercom.eu/pl/strona-glowna/",
"innerText" : "Polski"
},
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : "Search"
},
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : "SKOV-SERCOM B.V."
},
{
"href" : "https://www.sercom.eu/en/homepage/#",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : "HOME"
},
{
"href" : "https://www.sercom.eu/en/about-us/",
"innerText" : "ABOUT US"
},
{
"href" : "https://www.sercom.eu/en/service-overview/",
"innerText" : "SERVICE"
},
{
"href" : "https://www.sercom.eu/en/news/",
"innerText" : "NEWS"
},
{
"href" : "https://www.sercom.eu/en/contact-us/",
"innerText" : "CONTACT US"
},
{
"href" : "https://www.sercom.eu/en/homepage/#pll_switcher",
"innerText" : "ENGLISH"
},
{
"href" : "https://www.sercom.eu/nl/startpagina/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/de/startseite/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/ru/%d0%b4%d0%be%d0%bc%d0%b0%d1%88%d0%bd%d1%8f%d1%8f-%d1%81%d1%82%d1%80%d0%b0%d0%bd%d0%b8%d1%86%d0%b0/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/es/inicio/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/pl/strona-glowna/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : "SEARCH"
},
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/homepage/",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/homepage/greenhouse-horticulture/",
"innerText" : "SKOV-SERCOM products for the greenhouse horticulture"
},
{
"href" : "https://www.sercom.eu/en/homepage/flower-bulbs/",
"innerText" : "SKOV-SERCOM products for the flower bulb sector"
},
{
"href" : "https://www.sercom.eu/en/homepage/potato-storage/",
"innerText" : "SKOV-SERCOM products for the arable farming storage"
},
{
"href" : "https://www.sercom.eu/en/homepage/chicory/",
"innerText" : "SKOV-SERCOM products for the chicory sector"
},
{
"href" : "https://sercom.eu/en/homepage/vertical-farming/",
"innerText" : "SKOV-SERCOM products for vertical farming"
},
{
"href" : "https://www.sercom.eu/en/homepage/cold-storage/",
"innerText" : "SKOV-SERCOM products for the cold storage sector"
},
{
"href" : "https://sercom.eu/en/homepage/open-field/",
"innerText" : "SKOV-SERCOM products for open field"
},
{
"href" : "https://www.sercom.eu/en/homepage/co-no-safety-device/",
"innerText" : "SKOV-SERCOM CO safety device"
},
{
"href" : "https://www.sercom.eu/en/contact-us/company-details/",
"innerText" : "phone"
},
{
"href" : "https://www.sercom.eu/en/contact-us/contact-form/",
"innerText" : "email/contact form"
},
{
"href" : "https://www.sercom.eu/#facebook",
"innerText" : "Facebook"
},
{
"href" : "https://www.sercom.eu/#linkedin",
"innerText" : "LinkedIn"
},
{
"href" : "https://www.sercom.eu/#x",
"innerText" : "X"
},
{
"href" : "https://www.sercom.eu/#whatsapp",
"innerText" : "WhatsApp"
},
{
"href" : "https://www.sercom.eu/#telegram",
"innerText" : "Telegram"
},
{
"href" : "https://www.sercom.eu/#email",
"innerText" : "Email"
},
{
"href" : "https://www.sercom.eu/#printfriendly",
"innerText" : "PrintFriendly"
},
{
"href" : "https://www.sercom.eu/#copy_link",
"innerText" : "Copy Link"
},
{
"href" : "https://www.addtoany.com/share#url=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&title=How%20can%20we%20help%20you%3F",
"innerText" : "Share"
},
{
"href" : "https://www.sercom.eu/wp-content/uploads/2025/08/SKOV-SERCOM-company-brochure.pdf",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/product-flyers/",
"innerText" : ""
},
{
"href" : "https://www.youtube.com/watch?v=UVfiqymVcEE",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/dealers-per-continent/",
"innerText" : ""
},
{
"href" : "https://sercom.eu/en/events-calendar/",
"innerText" : ""
},
{
"href" : "mailto:info@skov-sercom.nl",
"innerText" : "info@skov-sercom.nl"
},
{
"href" : "https://sercom.eu/en/privacy-policy/",
"innerText" : "Privacy policy"
},
{
"href" : "https://sercom.eu/en/cookie-policy/",
"innerText" : "Cookies"
},
{
"href" : "https://www.sercom.eu/en/metaalunie-conditions/",
"innerText" : "Metaalunie conditions"
},
{
"href" : "https://www.facebook.com/skovsercom",
"innerText" : ""
},
{
"href" : "https://www.linkedin.com/company/skov-sercom-bv/",
"innerText" : ""
},
{
"href" : "https://www.instagram.com/skovsercom/",
"innerText" : ""
},
{
"href" : "https://www.x.com/skovsercom",
"innerText" : ""
},
{
"href" : "https://www.youtube.com/@skovsercom",
"innerText" : ""
},
{
"href" : "https://www.sercom.eu/en/sercommunication/",
"innerText" : ""
},
{
"href" : "https://sercom.eu/en/homepage/wireless-xtender/",
"innerText" : ""
},
{
"href" : "http://www.sercom.eu/pl/polityka-prywatnosci/",
"innerText" : "Polityka prywatności"
},
{
"href" : "http://www.sercom.eu/pl/polityka-cookies/",
"innerText" : "Cookies"
},
{
"href" : "http://www.cryoutcreations.eu/wordpress-themes/fluida",
"innerText" : "Fluida"
},
{
"href" : "http://wordpress.org/",
"innerText" : "WordPress."
},
{
"href" : "https://www.addtoany.com/",
"innerText" : "AddToAny"
},
{
"href" : "https://www.sercom.eu/en/homepage/#addtoany",
"innerText" : "More…"
},
{
"href" : "https://www.sercom.eu/en/growtech-antalya-2025/",
"innerText" : ""
}
],
"imgs" : [
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/05/SKOV-SERCOM-slogan_960p.png",
"title" : "",
"alt" : "SKOV-SERCOM B.V."
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAt1BMVEWSmb66z+18msdig8La3u+tYX9IaLc7W7BagbmcUW+kqMr/q6n+//+hsNv/lIr/jIGMnNLJyOP9/fyQttT/wb3/////aWn+YWF5kNT0oqz0i4ueqtIZNJjhvt/8gn//WVr/6+rN1+o9RKZwgcMPJpX/VFT9UEn+RUX8Ozv2Ly+FGzdYZrfU1e/8LS/lQkG/mbVUX60AE231hHtcdMb0mp3qYFTFwNu3w9prcqSURGNDaaIUMX5FNW5wYt7AAAAAjklEQVR4AR3HNUJEMQCGwf+L8RR36ajR+1+CEuvRdd8kK9MNAiRQNgJmVDAt1yM6kSzYVJUsPNssAk5N7ZFKjVNFAY4co6TAOI+kyQm+LFUEBEKKzuWUNB7rSH/rSnvOulOGk+QlXTBqMIrfYX4tSe2nP3iRa/KNK7uTmWJ5a9+erZ3d+18od4ytiZdvZyuKWy8o3UpTVAAAAABJRU5ErkJggg==",
"title" : "",
"alt" : "English"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAY1BMVEX/AAD8AADzAADqAAD/fYz+dYT6aHr7XG36VGb6R1f4L0H/ECz+mKXw8fH9/f36+vr19vbW1tbS0tIAG493n89cjcZNgsA/eLkzcbUpaLAcYKwAAFEAA4ANU6UAADsAAHgAAGcSgiW+AAAAS0lEQVR4AQXBiQ3CQBAAMc/dConQf688SoIdBIIyQiR9R0tCuM2rNxHpMqsDIWiBEE4NgnBiHhVJcs48P0uSjXsPl4hLmH2EHzb4A7DPDGppZMSwAAAAAElFTkSuQmCC",
"title" : "",
"alt" : "Nederlands"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAIAAAD5gJpuAAABLElEQVR4AY2QgUZEQRSGz9ydmzbYkBWABBJYABHEFhJ6m0WP0DMEQNIr9AKrN8ne2Tt3Zs7MOdOZmRBEv+v34Tvub9R6fdNlAzU+snSME/wdjbjbbJ6EiEg6BA8102QbjKNpoMzw8v6qD/sOALbbT2MC1NgaAWOKOgxf5czY+4dbAX2G/THzcozLrvPV85IQyqVz0rvg2p9Pei4HjzSsiFbV4JgyhhxCjpGdZ0RhdikLB9/b8Qig7MkpSovR7Cp59q6CazaNFiTt4J82o6uvdMVwTsztKTXZod4jgOJJuqNAjFyGrBR8gM6XwKfIC4KanBSTZ0rClKh08D9DFh3egW7ebH7NcRDQWrz9rM2Ne+mDOXB2mZJ8agL19nwxR2iZXGm1gDbQKhDjd4yHb2oW/KR8xHicAAAAAElFTkSuQmCC",
"title" : "",
"alt" : "Deutsch"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAdVBMVEX19f/u7vjm5/H+/v75+fng4Ove3ulFRfyysv6cnP6QkPmIiPh/f/YAAOYAAP1ycv5QUP06OvkxMfcoKPcgIPYUFPS0AADdaYzTRG/RPGnOM2LKLFzIIVPCEUZ7AAD0AQH7YGH3ODj0JyfzERDgAAD4TU3pAABIfLuPAAAAT0lEQVR4AQXBAQqDMAAAsZytyHzA/v9LYRS7JIAQMkBb0ATsgLoKInnHvIrHrdRaBzxupTDxuFUifUsp4R3zU4iwzmOyT1ibBtP2u3C+wB+SHBB5JNY7DAAAAABJRU5ErkJggg==",
"title" : "",
"alt" : "Русский"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAflBMVEX/AAD9AAD3AADxAADrAAD/eXn9bGz8YWH8WVn6UVH5SEj5Pz/3NDT0Kir9/QD+/nL+/lT18lDt4Uf6+j/39zD39yf19R3n5wDxflXsZ1Pt4Y3x8zr0wbLs1NXz8xPj4wD37t3jmkvsUU/Bz6nrykm3vJ72IiL0FBTyDAvhAABEt4UZAAAAX0lEQVR4AQXBQUrFQBBAwXqTDkYE94Jb73+qfwVRcYxVQRBRToiUfoaVpGTrtdS9SO0Z9FR9lVy/g5c99+dKl30N5uxPuviexXEc9/msC7TOkd4kHu/Dlh4itCJ8AP4B0w4Qwmm7CFQAAAAASUVORK5CYII=",
"title" : "",
"alt" : "Español"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAPFBMVEX/8fH67Ozz5ubt4OD+/v77+/v39/fo2Nj5AAD+jo79bW36X1/4T0/5QUHhAAD3MzP0Kir2ICDzERHtAACO5h0ZAAAAQUlEQVR4AQXBsRHDMAwAMTzNwvuvm5MVIECIZIEQZ4EQ7AAIGBABegsR+Z7VxChx7hCjhIwYJcTydcgQ1gv8Lhd/58kJTU6WtnIAAAAASUVORK5CYII=",
"title" : "",
"alt" : "Polski"
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/05/SKOV-SERCOM-slogan_960p.png",
"title" : "",
"alt" : "SKOV-SERCOM B.V."
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAt1BMVEWSmb66z+18msdig8La3u+tYX9IaLc7W7BagbmcUW+kqMr/q6n+//+hsNv/lIr/jIGMnNLJyOP9/fyQttT/wb3/////aWn+YWF5kNT0oqz0i4ueqtIZNJjhvt/8gn//WVr/6+rN1+o9RKZwgcMPJpX/VFT9UEn+RUX8Ozv2Ly+FGzdYZrfU1e/8LS/lQkG/mbVUX60AE231hHtcdMb0mp3qYFTFwNu3w9prcqSURGNDaaIUMX5FNW5wYt7AAAAAjklEQVR4AR3HNUJEMQCGwf+L8RR36ajR+1+CEuvRdd8kK9MNAiRQNgJmVDAt1yM6kSzYVJUsPNssAk5N7ZFKjVNFAY4co6TAOI+kyQm+LFUEBEKKzuWUNB7rSH/rSnvOulOGk+QlXTBqMIrfYX4tSe2nP3iRa/KNK7uTmWJ5a9+erZ3d+18od4ytiZdvZyuKWy8o3UpTVAAAAABJRU5ErkJggg==",
"title" : "",
"alt" : "English"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAY1BMVEX/AAD8AADzAADqAAD/fYz+dYT6aHr7XG36VGb6R1f4L0H/ECz+mKXw8fH9/f36+vr19vbW1tbS0tIAG493n89cjcZNgsA/eLkzcbUpaLAcYKwAAFEAA4ANU6UAADsAAHgAAGcSgiW+AAAAS0lEQVR4AQXBiQ3CQBAAMc/dConQf688SoIdBIIyQiR9R0tCuM2rNxHpMqsDIWiBEE4NgnBiHhVJcs48P0uSjXsPl4hLmH2EHzb4A7DPDGppZMSwAAAAAElFTkSuQmCC",
"title" : "",
"alt" : "Nederlands"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAIAAAD5gJpuAAABLElEQVR4AY2QgUZEQRSGz9ydmzbYkBWABBJYABHEFhJ6m0WP0DMEQNIr9AKrN8ne2Tt3Zs7MOdOZmRBEv+v34Tvub9R6fdNlAzU+snSME/wdjbjbbJ6EiEg6BA8102QbjKNpoMzw8v6qD/sOALbbT2MC1NgaAWOKOgxf5czY+4dbAX2G/THzcozLrvPV85IQyqVz0rvg2p9Pei4HjzSsiFbV4JgyhhxCjpGdZ0RhdikLB9/b8Qig7MkpSovR7Cp59q6CazaNFiTt4J82o6uvdMVwTsztKTXZod4jgOJJuqNAjFyGrBR8gM6XwKfIC4KanBSTZ0rClKh08D9DFh3egW7ebH7NcRDQWrz9rM2Ne+mDOXB2mZJ8agL19nwxR2iZXGm1gDbQKhDjd4yHb2oW/KR8xHicAAAAAElFTkSuQmCC",
"title" : "",
"alt" : "Deutsch"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAdVBMVEX19f/u7vjm5/H+/v75+fng4Ove3ulFRfyysv6cnP6QkPmIiPh/f/YAAOYAAP1ycv5QUP06OvkxMfcoKPcgIPYUFPS0AADdaYzTRG/RPGnOM2LKLFzIIVPCEUZ7AAD0AQH7YGH3ODj0JyfzERDgAAD4TU3pAABIfLuPAAAAT0lEQVR4AQXBAQqDMAAAsZytyHzA/v9LYRS7JIAQMkBb0ATsgLoKInnHvIrHrdRaBzxupTDxuFUifUsp4R3zU4iwzmOyT1ibBtP2u3C+wB+SHBB5JNY7DAAAAABJRU5ErkJggg==",
"title" : "",
"alt" : "Русский"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAflBMVEX/AAD9AAD3AADxAADrAAD/eXn9bGz8YWH8WVn6UVH5SEj5Pz/3NDT0Kir9/QD+/nL+/lT18lDt4Uf6+j/39zD39yf19R3n5wDxflXsZ1Pt4Y3x8zr0wbLs1NXz8xPj4wD37t3jmkvsUU/Bz6nrykm3vJ72IiL0FBTyDAvhAABEt4UZAAAAX0lEQVR4AQXBQUrFQBBAwXqTDkYE94Jb73+qfwVRcYxVQRBRToiUfoaVpGTrtdS9SO0Z9FR9lVy/g5c99+dKl30N5uxPuviexXEc9/msC7TOkd4kHu/Dlh4itCJ8AP4B0w4Qwmm7CFQAAAAASUVORK5CYII=",
"title" : "",
"alt" : "Español"
},
{
"src" : "data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAALCAMAAABBPP0LAAAAPFBMVEX/8fH67Ozz5ubt4OD+/v77+/v39/fo2Nj5AAD+jo79bW36X1/4T0/5QUHhAAD3MzP0Kir2ICDzERHtAACO5h0ZAAAAQUlEQVR4AQXBsRHDMAwAMTzNwvuvm5MVIECIZIEQZ4EQ7AAIGBABegsR+Z7VxChx7hCjhIwYJcTydcgQ1gv8Lhd/58kJTU6WtnIAAAAASUVORK5CYII=",
"title" : "",
"alt" : "Polski"
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2020/11/Header2-%C2%A9-Lisanne-Mesman.jpg",
"title" : "",
"alt" : "SKOV-SERCOM B.V."
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2020/11/Header2-%C2%A9-Lisanne-Mesman-751x200.jpg",
"title" : "",
"alt" : "How can we help you?"
},
{
"src" : "https://sercom.eu/wp-content/uploads/2020/09/UK_Greenhouse-horticulture.jpg",
"title" : "Greenhouse horticulture",
"alt" : "process automation"
},
{
"src" : "https://sercom.eu/wp-content/uploads/2020/09/UK_Flower-bulbs.jpg",
"title" : "Flower bulbs",
"alt" : "process automation"
},
{
"src" : "https://sercom.eu/wp-content/uploads/2020/09/UK_Potato-storage.jpg",
"title" : "Potato storage",
"alt" : "process automation"
},
{
"src" : "https://sercom.eu/wp-content/uploads/2020/09/UK_Chicory.jpg",
"title" : "Chicory",
"alt" : "process automation"
},
{
"src" : "https://sercom.eu/wp-content/uploads/2021/07/UK_Vertical-farming.jpg",
"title" : "Vertical farming",
"alt" : "process automation"
},
{
"src" : "https://sercom.eu/wp-content/uploads/2020/09/UK_Cold-storage.jpg",
"title" : "Cold storage",
"alt" : "process automation"
},
{
"src" : "https://sercom.eu/wp-content/uploads/2021/07/UK_Open-field.jpg",
"title" : "Open field",
"alt" : "process automation"
},
{
"src" : "https://sercom.eu/wp-content/uploads/2020/09/UK_CO-safety-device.jpg",
"title" : "CO safety device",
"alt" : "process automation"
},
{
"src" : "https://s.w.org/images/core/emoji/13.1.0/svg/1f1f3-1f1f1.svg",
"title" : "",
"alt" : "🇳🇱"
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/08/Company-brochure.webp",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/08/Product-flyers.webp",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/08/Company-movie-YouTube.webp",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/08/Dealers.webp",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/08/Events.webp",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/05/Facebook_footer.png",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/05/LinkedIn_footer.png",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/05/Instagram_footer.png",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/05/X_footer.png",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/05/YouTube_footer.png",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/09/SKOV-SERCOMmunication-startpagina.webp",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/08/Wireless-Xtender-footer.webp",
"title" : "",
"alt" : ""
},
{
"src" : "https://www.sercom.eu/wp-content/uploads/2025/11/GROWTECH.-Antalya_en.webp",
"title" : "GROWTECH. Antalya 2025",
"alt" : ""
}
],
"forms" : [
{
"action" : "https://www.sercom.eu/en/"
},
{
"action" : "https://www.sercom.eu/en/"
}
],
"headings" : [
{
"h" : "h1",
"innerText" : "SKOV-SERCOM B.V."
},
{
"h" : "h2",
"innerText" : "How can we help you?"
},
{
"h" : "h2",
"innerText" : "SKOV-SERCOM B.V."
},
{
"h" : "h2",
"innerText" : "FOLLOW US ON SOCIAL MEDIA"
},
{
"h" : "h2",
"innerText" : "NEWSLETTER"
},
{
"h" : "h2",
"innerText" : "WIRELESS XTENDER"
}
],
"paragraphs" : [
{
"innerText" : "Do you want to know what we could do for you? Click on one of the images below to get more information on the different sectors."
},
{
"innerText" : "SKOV-SERCOM builds cleverly designed electronics and computers for process automation. We are specialised in above mentioned sectors and we can provide complete automation for every horticultural or flower bulb company. Our customers appreciate having only one contact person who speaks their language."
},
{
"innerText" : "Our product portfolio consists of: process computers, accessory equipment, software and technical solutions for optimising the regulation process."
},
{
"innerText" : "Want to contact us? You can reach us by phone or email/contact form."
},
{
"innerText" : "Made in Holland"
},
{
"innerText" : "Heereweg 9\n2161 AB Lisse\nThe Netherlands"
},
{
"innerText" : "+31 (0)252 41 65 30"
},
{
"innerText" : "info@skov-sercom.nl"
},
{
"innerText" : ""
},
{
"innerText" : "Privacy policy"
},
{
"innerText" : "Cookies"
},
{
"innerText" : "Metaalunie conditions"
}
]
},
"word_stats" : [
{
"word" : "skovsercom",
"count" : 10
},
{
"word" : "products",
"count" : 7
},
{
"word" : "contact",
"count" : 3
},
{
"word" : "sector",
"count" : 3
},
{
"word" : "automation",
"count" : 2
},
{
"word" : "bulb",
"count" : 2
},
{
"word" : "computers",
"count" : 2
},
{
"word" : "farming",
"count" : 2
},
{
"word" : "flower",
"count" : 2
},
{
"word" : "process",
"count" : 2
},
{
"word" : "storage",
"count" : 2
},
{
"word" : "ab",
"count" : 1
},
{
"word" : "accessory",
"count" : 1
},
{
"word" : "appreciate",
"count" : 1
},
{
"word" : "arable",
"count" : 1
},
{
"word" : "back",
"count" : 1
},
{
"word" : "builds",
"count" : 1
},
{
"word" : "chicory",
"count" : 1
},
{
"word" : "cleverly",
"count" : 1
},
{
"word" : "click",
"count" : 1
},
{
"word" : "co",
"count" : 1
},
{
"word" : "cold",
"count" : 1
},
{
"word" : "company",
"count" : 1
},
{
"word" : "complete",
"count" : 1
},
{
"word" : "conditions",
"count" : 1
},
{
"word" : "consists",
"count" : 1
},
{
"word" : "content",
"count" : 1
},
{
"word" : "cookies",
"count" : 1
},
{
"word" : "customers",
"count" : 1
},
{
"word" : "designed",
"count" : 1
},
{
"word" : "device",
"count" : 1
},
{
"word" : "different",
"count" : 1
},
{
"word" : "electronics",
"count" : 1
},
{
"word" : "emailcontact",
"count" : 1
},
{
"word" : "english",
"count" : 1
},
{
"word" : "equipment",
"count" : 1
},
{
"word" : "facebooklinkedinxwhatsapptelegramemailprintfriendlycopy",
"count" : 1
},
{
"word" : "field",
"count" : 1
},
{
"word" : "follow",
"count" : 1
},
{
"word" : "get",
"count" : 1
},
{
"word" : "greenhouse",
"count" : 1
},
{
"word" : "having",
"count" : 1
},
{
"word" : "help",
"count" : 1
},
{
"word" : "holland",
"count" : 1
},
{
"word" : "home",
"count" : 1
},
{
"word" : "horticultural",
"count" : 1
},
{
"word" : "horticulture",
"count" : 1
},
{
"word" : "how",
"count" : 1
},
{
"word" : "images",
"count" : 1
},
{
"word" : "information",
"count" : 1
},
{
"word" : "know",
"count" : 1
},
{
"word" : "linkshare",
"count" : 1
},
{
"word" : "lisse",
"count" : 1
},
{
"word" : "made",
"count" : 1
},
{
"word" : "media",
"count" : 1
},
{
"word" : "mentioned",
"count" : 1
},
{
"word" : "metaalunie",
"count" : 1
},
{
"word" : "netherlands",
"count" : 1
},
{
"word" : "news",
"count" : 1
},
{
"word" : "newsletter",
"count" : 1
},
{
"word" : "only",
"count" : 1
},
{
"word" : "open",
"count" : 1
},
{
"word" : "optimising",
"count" : 1
},
{
"word" : "our",
"count" : 1
},
{
"word" : "person",
"count" : 1
},
{
"word" : "phone",
"count" : 1
},
{
"word" : "policy",
"count" : 1
},
{
"word" : "portfolio",
"count" : 1
},
{
"word" : "product",
"count" : 1
},
{
"word" : "provide",
"count" : 1
},
{
"word" : "reach",
"count" : 1
},
{
"word" : "regulation",
"count" : 1
},
{
"word" : "safety",
"count" : 1
},
{
"word" : "search",
"count" : 1
},
{
"word" : "sectors",
"count" : 1
},
{
"word" : "service",
"count" : 1
},
{
"word" : "settings",
"count" : 1
},
{
"word" : "skip",
"count" : 1
},
{
"word" : "social",
"count" : 1
},
{
"word" : "software",
"count" : 1
},
{
"word" : "solutions",
"count" : 1
},
{
"word" : "speaks",
"count" : 1
},
{
"word" : "specialised",
"count" : 1
},
{
"word" : "technical",
"count" : 1
},
{
"word" : "their",
"count" : 1
},
{
"word" : "top",
"count" : 1
},
{
"word" : "vertical",
"count" : 1
},
{
"word" : "via",
"count" : 1
},
{
"word" : "want",
"count" : 1
},
{
"word" : "what",
"count" : 1
},
{
"word" : "who",
"count" : 1
},
{
"word" : "wireless",
"count" : 1
},
{
"word" : "xtender",
"count" : 1
}
],
"word_nouns_stats" : [
{
"noun" : "skovsercom",
"count" : 10
},
{
"noun" : "products",
"count" : 7
},
{
"noun" : "contact",
"count" : 3
},
{
"noun" : "sector",
"count" : 3
},
{
"noun" : "automation",
"count" : 2
},
{
"noun" : "bulb",
"count" : 2
},
{
"noun" : "computers",
"count" : 2
},
{
"noun" : "farming",
"count" : 2
},
{
"noun" : "flower",
"count" : 2
},
{
"noun" : "process",
"count" : 2
},
{
"noun" : "storage",
"count" : 2
},
{
"noun" : "accessory",
"count" : 1
},
{
"noun" : "arable",
"count" : 1
},
{
"noun" : "back",
"count" : 1
},
{
"noun" : "builds",
"count" : 1
},
{
"noun" : "chicory",
"count" : 1
},
{
"noun" : "click",
"count" : 1
},
{
"noun" : "cold",
"count" : 1
},
{
"noun" : "company",
"count" : 1
},
{
"noun" : "conditions",
"count" : 1
},
{
"noun" : "cookies",
"count" : 1
},
{
"noun" : "customers",
"count" : 1
},
{
"noun" : "device",
"count" : 1
},
{
"noun" : "electronics",
"count" : 1
},
{
"noun" : "emailcontact",
"count" : 1
},
{
"noun" : "equipment",
"count" : 1
},
{
"noun" : "field",
"count" : 1
},
{
"noun" : "greenhouse",
"count" : 1
},
{
"noun" : "holland",
"count" : 1
},
{
"noun" : "home",
"count" : 1
},
{
"noun" : "horticultural",
"count" : 1
},
{
"noun" : "horticulture",
"count" : 1
},
{
"noun" : "images",
"count" : 1
},
{
"noun" : "information",
"count" : 1
},
{
"noun" : "lisse",
"count" : 1
}
],
"all_request_urls_before_consent" : [
"https://www.sercom.eu/en/homepage/",
"https://www.sercom.eu/wp-content/plugins/smooth-back-to-top-button/assets/css/smooth-back-to-top-button.css?ver=1.1.15",
"https://www.sercom.eu/wp-includes/css/dist/block-library/style.min.css?ver=5.9.12",
"https://www.sercom.eu/wp-content/plugins/smooth-back-to-top-button/assets/css/sbttb-fonts.css?ver=1.1.15",
"https://www.sercom.eu/wp-content/plugins/the-post-grid/assets/vendor/font-awesome/css/font-awesome.min.css?ver=7.7.19",
"https://www.sercom.eu/wp-content/plugins/the-post-grid/assets/css/thepostgrid.min.css?ver=7.7.19",
"https://www.sercom.eu/wp-content/plugins/complianz-gdpr/assets/css/cookieblocker.min.css?ver=1742220153",
"https://www.sercom.eu/wp-content/themes/fluida/resources/fonts/fontfaces.css?ver=1.8.6.2",
"https://www.sercom.eu/wp-content/themes/fluida/style.css?ver=1.8.6.2",
"https://www.sercom.eu/wp-content/plugins/add-to-any/addtoany.min.css?ver=1.16",
"https://www.sercom.eu/wp-content/plugins/boxzilla/assets/css/styles.css?ver=3.4.4",
"https://www.sercom.eu/wp-content/uploads/2025/05/SKOV-SERCOM-slogan_960p.png",
"https://www.sercom.eu/wp-content/uploads/2020/11/Header2-%C2%A9-Lisanne-Mesman.jpg",
"https://www.sercom.eu/wp-includes/js/jquery/jquery-migrate.min.js?ver=3.3.2",
"https://www.sercom.eu/wp-includes/js/jquery/jquery.min.js?ver=3.6.0",
"https://www.sercom.eu/wp-content/uploads/2020/11/Header2-%C2%A9-Lisanne-Mesman-751x200.jpg",
"https://sercom.eu/wp-content/uploads/2020/09/UK_Greenhouse-horticulture.jpg",
"https://sercom.eu/wp-content/uploads/2020/09/UK_Flower-bulbs.jpg",
"https://www.sercom.eu/wp-content/plugins/image-caption-hover/css/simplegrid.css?ver=5.9.12",
"https://www.sercom.eu/wp-content/plugins/image-caption-hover/css/style.css?ver=5.9.12",
"https://www.sercom.eu/wp-content/plugins/image-caption-hover/css/ihover.min.css?ver=5.9.12",
"https://sercom.eu/wp-content/uploads/2020/09/UK_Potato-storage.jpg",
"https://sercom.eu/wp-content/uploads/2020/09/UK_Chicory.jpg",
"https://sercom.eu/wp-content/uploads/2021/07/UK_Vertical-farming.jpg",
"https://sercom.eu/wp-content/uploads/2020/09/UK_Cold-storage.jpg",
"https://sercom.eu/wp-content/uploads/2021/07/UK_Open-field.jpg",
"https://sercom.eu/wp-content/uploads/2020/09/UK_CO-safety-device.jpg",
"https://www.sercom.eu/wp-content/uploads/2025/08/Company-brochure.webp",
"https://www.sercom.eu/wp-content/uploads/2025/08/Company-movie-YouTube.webp",
"https://www.sercom.eu/wp-content/plugins/smooth-back-to-top-button/assets/js/smooth-back-to-top-button.js?ver=1.1.15",
"https://www.sercom.eu/wp-content/plugins/image-caption-hover/js/script.js?ver=5.9.12",
"https://www.sercom.eu/wp-content/plugins/boxzilla/assets/js/script.js?ver=3.4.4",
"https://www.sercom.eu/wp-content/plugins/beaver-builder-lite-version/js/jquery.imagesloaded.min.js?ver=2.8.6.1",
"https://www.sercom.eu/wp-includes/js/comment-reply.min.js?ver=5.9.12",
"https://www.sercom.eu/wp-content/plugins/add-to-any/addtoany.min.js?ver=1.1",
"https://www.sercom.eu/wp-content/uploads/2025/05/Facebook_footer.png",
"https://www.sercom.eu/wp-content/uploads/2025/09/SKOV-SERCOMmunication-startpagina.webp",
"https://www.sercom.eu/wp-content/uploads/2025/05/Instagram_footer.png",
"https://www.sercom.eu/wp-content/uploads/2025/05/LinkedIn_footer.png",
"https://www.sercom.eu/wp-content/uploads/2025/05/X_footer.png",
"https://static.addtoany.com/menu/page.js",
"https://www.sercom.eu/wp-content/uploads/2025/05/YouTube_footer.png",
"https://www.sercom.eu/wp-content/uploads/2025/08/Wireless-Xtender-footer.webp",
"https://www.sercom.eu/wp-content/uploads/2025/11/GROWTECH.-Antalya_en.webp",
"https://www.sercom.eu/wp-content/uploads/2025/08/Product-flyers.webp",
"https://www.sercom.eu/wp-content/uploads/2025/08/Dealers.webp",
"https://www.sercom.eu/wp-content/uploads/2025/08/Events.webp",
"https://www.sercom.eu/wp-content/plugins/smooth-back-to-top-button/assets/fonts/wpxpress.ttf?9zg56",
"https://www.sercom.eu/wp-content/themes/fluida/resources/fonts/elusive.woff",
"https://www.sercom.eu/wp-content/themes/fluida/resources/fonts/blocks.woff",
"https://www.sercom.eu/wp-includes/js/jquery/jquery.masonry.min.js?ver=3.1.2b",
"https://www.sercom.eu/wp-includes/js/wp-emoji-release.min.js?ver=5.9.12",
"https://www.sercom.eu/wp-content/themes/fluida/resources/js/frontend.js?ver=1.8.6.2",
"https://www.sercom.eu/wp-includes/js/masonry.min.js?ver=4.2.2",
"https://www.sercom.eu/wp-content/plugins/complianz-gdpr/cookiebanner/js/complianz.min.js?ver=1742220155",
"https://static.addtoany.com/menu/sm.25.html",
"https://www.sercom.eu/wp-content/uploads/complianz/css/banner-1-optin.css?v=14756",
"https://s.w.org/images/core/emoji/13.1.0/svg/1f1f3-1f1f1.svg",
"https://static.addtoany.com/menu/modules/core.oafg07ee.js",
"https://www.googletagmanager.com/gtm.js?id=GTM-KBWRQGK",
"https://static.addtoany.com/cdn-cgi/speculation",
"https://static.addtoany.com/menu/svg/icons/x.js",
"https://static.addtoany.com/menu/svg/icons/telegram.js",
"https://static.addtoany.com/menu/svg/icons/facebook.js",
"https://static.addtoany.com/menu/svg/icons/link.js",
"https://static.addtoany.com/menu/svg/icons/linkedin.js",
"https://static.addtoany.com/menu/svg/icons/whatsapp.js",
"https://static.addtoany.com/menu/svg/icons/email.js",
"https://static.addtoany.com/menu/svg/icons/printfriendly.js",
"https://static.addtoany.com/menu/svg/icons/a2a.js",
"https://www.googletagmanager.com/gtag/js?id=G-PH4HET5CSQ&cx=c>m=4e5bh1",
"https://www.googletagmanager.com/gtag/js?id=G-VW4CQMPE4W&cx=c>m=4e5bh1",
"https://www.sercom.eu/wp-content/uploads/2025/05/Favicon-website-512x512px-rond.png",
"https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bh1v899625038za200zb843174642zd843174642&_p=1763512357937&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=1926542854.1763512358&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_s=1&tag_exp=103116026~103200004~104527907~104528500~104684208~104684211~115583767~115938466~115938469~116217636~116217638~116474637&sid=1763512358&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=page_view&_fv=1&_nsi=1&_ss=1&_ee=1&tfd=701"
],
"all_request_urls_after_accept_all_consent" : [
"https://fonts.googleapis.com/css?family=Noto+sans%3A%7CUbuntu%3A%7CUbuntu+Condensed%3A%7CNoto+sans%3A100%2C200%2C300%2C400%2C500%2C600%2C700%2C800%2C900%7CUbuntu%3A100%2C200%2C300%2C400%2C500%2C600%2C700%2C800%2C900%7CNoto+sans%3A300%7CUbuntu%3A300%7CNoto+sans%3A700%7CUbuntu+Condensed%3A700%7CNoto+sans%3A100%7CUbuntu+Condensed%3A100&ver=1.8.6.2",
"https://www.googletagmanager.com/gtag/js?id=G-VW4CQMPE4W",
"https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bh1v899625038za200zb843174642zd843174642&_p=1763512357937&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=1926542854.1763512358&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_eu=AEAAAAQ&_s=2&tag_exp=103116026~103200004~104527907~104528500~104684208~104684211~115583767~115938466~115938469~116217636~116217638~116474637&sid=1763512358&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=scroll&epn.percent_scrolled=90&tfd=5734"
],
"all_request_urls_after_necessary_only_consent" : [
"https://region1.google-analytics.com/g/collect?v=2&tid=G-VW4CQMPE4W>m=45je5bi0h2v899625038za200zb843174642zd843174642&_p=1763512364905&gcd=13l3l3l2l1l1&npa=1&dma_cps=syphamo&dma=1&cid=22695101.1763512365&ul=en-us&sr=1368x768&uaa=&uab=&uafvl=&uamb=0&uam=&uap=Linux&uapv=&uaw=0&are=1&frm=0&pscdl=noapi&_eu=AEAAAAQ&_s=2&tag_exp=103116026~103200004~104527906~104528500~104684208~104684211~115583767~115938466~115938469~115985661~116217636~116217638&sid=1763512365&sct=1&seg=0&dl=https%3A%2F%2Fwww.sercom.eu%2Fen%2Fhomepage%2F&dt=SKOV-SERCOM%20B.V.%20%7C%20Horti%20Climate%20Solutions&en=scroll&epn.percent_scrolled=90&tfd=5680"
],
"full_cookies_before_consent" : [
{
"name" : "pll_language",
"value" : "en",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048358,
"size" : 14,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "_ga",
"value" : "GA1.1.1926542854.1763512358",
"domain" : ".sercom.eu",
"path" : "/",
"expires" : 1798072358.38519,
"size" : 30,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "_ga_VW4CQMPE4W",
"value" : "GS2.1.s1763512358$o1$g0$t1763512358$j60$l0$h0",
"domain" : ".sercom.eu",
"path" : "/",
"expires" : 1798072358.42072,
"size" : 59,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "boxzilla_box_55769",
"value" : "1",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1767112359,
"size" : 19,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
}
],
"full_cookies_after_accept_all_consent" : [
{
"name" : "pll_language",
"value" : "en",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048358,
"size" : 14,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "_ga",
"value" : "GA1.1.1926542854.1763512358",
"domain" : ".sercom.eu",
"path" : "/",
"expires" : 1798072358.38519,
"size" : 30,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "_ga_VW4CQMPE4W",
"value" : "GS2.1.s1763512358$o1$g0$t1763512358$j60$l0$h0",
"domain" : ".sercom.eu",
"path" : "/",
"expires" : 1798072358.42072,
"size" : 59,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "boxzilla_box_55769",
"value" : "1",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1767112359,
"size" : 19,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_consented_services",
"value" : "",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048360,
"size" : 24,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_policy_id",
"value" : "30",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048360,
"size" : 17,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_marketing",
"value" : "allow",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048360,
"size" : 20,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_statistics",
"value" : "allow",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048360,
"size" : 21,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_preferences",
"value" : "allow",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048360,
"size" : 22,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_functional",
"value" : "allow",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048360,
"size" : 21,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_banner-status",
"value" : "dismissed",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048360,
"size" : 28,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
}
],
"full_cookies_after_necessary_only_consent" : [
{
"name" : "pll_language",
"value" : "en",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048364,
"size" : 14,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "_ga",
"value" : "GA1.1.22695101.1763512365",
"domain" : ".sercom.eu",
"path" : "/",
"expires" : 1798072365.32259,
"size" : 28,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "_ga_VW4CQMPE4W",
"value" : "GS2.1.s1763512365$o1$g0$t1763512365$j60$l0$h0",
"domain" : ".sercom.eu",
"path" : "/",
"expires" : 1798072365.33309,
"size" : 59,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "boxzilla_box_55769",
"value" : "1",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1767112365,
"size" : 19,
"httpOnly" : false,
"secure" : false,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_banner-status",
"value" : "dismissed",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048367,
"size" : 28,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_policy_id",
"value" : "30",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048367,
"size" : 17,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_marketing",
"value" : "deny",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048367,
"size" : 19,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_statistics",
"value" : "deny",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048367,
"size" : 20,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_preferences",
"value" : "deny",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048367,
"size" : 21,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_functional",
"value" : "allow",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048367,
"size" : 21,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
},
{
"name" : "cmplz_consented_services",
"value" : "",
"domain" : "www.sercom.eu",
"path" : "/",
"expires" : 1795048367,
"size" : 24,
"httpOnly" : false,
"secure" : true,
"session" : false,
"priority" : "Medium",
"sameParty" : false,
"sourceScheme" : "Secure",
"sourcePort" : 443
}
]
}